PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000021.1_g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 292aa    MW: 31057.8 Da    PI: 8.0916
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000021.1_g00029.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.46.2e-3269122357
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                              ++rY+eClkNhAas+Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR+e 
  Itr_sc000021.1_g00029.1  69 RARYRECLKNHAASIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKER 122
                              689*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2365121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-2970122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.9E-3171121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.96172121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466899.87E-18205274IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28212274IPR009057Homeodomain-like
TIGRFAMsTIGR015653.4E-27213270IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMALTGEDKE IRMSDSLAGY NPLEDLDQAA AAAAQDLQHG GATNISPAAA CGGGGVFKSK  60
LSTTAGAPRA RYRECLKNHA ASIGGNVTDG CGEFMPSGEE GTLEALKCAA CNCHRNFHRK  120
ERAGGGDGIL VVHPLQLPGA PPMPSPSSIN HHHHRNSPWG APTSLAAQPV KMAFGSGGGG  180
GSAATDSSSE ELNFNAYQSS SAIPSQPGLI LAKKRYRTKF SQEQKDKMLD FAEKLGWRIP  240
REDDTQLQTF CAEVGVKRQV FKVWMHNNKN SAKKNTPQQE QDHQQPPGIA GI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242142721876ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763792.15e-99PREDICTED: zinc-finger homeodomain protein 5-like
RefseqXP_016490581.15e-99PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9FRL51e-64ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLA0A068UH151e-102A0A068UH15_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000095812e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.15e-63homeobox protein 33